Tackle.net Logo
Tackle.net Logo
Sign up / Login
FishGPT
  • Lure Radar
  • Videos
  • Lure vs Lure
Lure LibrarySwimbaits iconSwimbaitSoft Swimbaits iconSoftTopwater Baits iconTop WaterGlide Baits iconGlideCrankbaits iconCrankJerkbaits iconJerkSpinnerbaits iconSpinnerBuzzbaits iconBuzzSoft Plastics iconPlasticsFrogs iconFrogsJigs iconJigs

Nice Pre-Spawn Bass" ODA 5" Stik Bait

Jon B.
Jon B.
New Project 62...
NewProject62kayakmichiganfishamerican footballarcheryhuntingbikefishingdetroitflylakecatchnicerapidscityriverbasssalmonnorthernoutdoorscarppiketroutmarshtips & tricksarbor
May 8, 2011
Ask FishGPT

Watch more

Fishing Videos
Loading...
Loading...
Tackle.net

The marketplace for custom fishing lures, handmade baits, and tackle from independent makers.

FacebookInstagramTikTokYouTube
Browse LuresFind MakersBuy & Sell Group

Explore

  • Lure Library
  • Browse Makers
  • Lure Radar
  • Videos
  • Lure vs Lure
  • Buy & Sell Bass Tackle

Company

  • About
  • Help
  • Terms
  • Privacy

Sponsored

© 2026 Tackle.net. All rights reserved.

Affiliate Disclosure: Some links may earn us a commission.

    RADARDiscover lures on eBay

    What's In My TACKLE BOX ! (Travel Fishing Box)
    10:04

    What's In My TACKLE BOX ! (Travel Fishing Box)

    The Tush Rig…Hottest Swimbait Rigging Method In Bass Fishing…
    06:14

    The Tush Rig…Hottest Swimbait Rigging Method In Bass Fishing…

    St.Johns River Bassmaster Elite Tournament Recap (The Plan, The Practice & The Result)
    07:56

    St.Johns River Bassmaster Elite Tournament Recap (The Plan, The Practice & The Result)

    Target Bass With Single Prop Topwater Baits
    06:21

    Target Bass With Single Prop Topwater Baits

    You’ll Never Release A Bass Again Without Smelling It After Watching THIS…
    08:12

    You’ll Never Release A Bass Again Without Smelling It After Watching THIS…

    This WEIRD Tiny Lure is AWESOME! - (TLC Ep.9)
    06:20

    This WEIRD Tiny Lure is AWESOME! - (TLC Ep.9)

    On The Water Arguments
    03:01

    On The Water Arguments

    ***CLOSED****New KICK ASS PowerTeam Lure Contest
    04:58

    ***CLOSED****New KICK ASS PowerTeam Lure Contest

    Tommy Biffle Exclusive Interview - Bass Fishing Pro
    04:07

    Tommy Biffle Exclusive Interview - Bass Fishing Pro

    👀 Check Out The LIPSTICK On This Bass! 👀
    00:48

    👀 Check Out The LIPSTICK On This Bass! 👀

    Another 5 pounder for Ray Hanselman
    03:45

    Another 5 pounder for Ray Hanselman

    The BIGGEST One of the Year || Catching an Absolute Monster on Topwater!
    15:31

    The BIGGEST One of the Year || Catching an Absolute Monster on Topwater!

    • Romanmade Mother Premium Triple Swimbait for Freshwater & Saltwater Fishing

      Romanmade Mother Premium Triple Swimbait for Freshwater & Saltwater Fishing

      Romanmade Mother Premium Triple Swimbait for Freshwater & Saltwater Fishing

      $925.31
    • Hinkle Trout 11” No Dot Rainbow Swimbait Glide Bait Bass Fishing Lure

      Hinkle Trout 11” No Dot Rainbow Swimbait Glide Bait Bass Fishing Lure

      Hinkle Trout 11” No Dot Rainbow Swimbait Glide Bait Bass Fishing Lure

      $999.99
    • Hinkle Shad Purple Shad Swimbait Glide Bait Bass Fishing Lure

      Hinkle Shad Purple Shad Swimbait Glide Bait Bass Fishing Lure

      Hinkle Shad Purple Shad Swimbait Glide Bait Bass Fishing Lure

      $999.99
    • Deps Silent Killer 145 Swimbait Old Model Discontinued Japan Lure

      Deps Silent Killer 145 Swimbait Old Model Discontinued Japan Lure

      Deps Silent Killer 145 Swimbait Old Model Discontinued Japan Lure

      $999.00
    • SUPER TUFF FIND!VINTAGE 1st PRODUCTION RUN REACTION STRIKE SWIMBAIT LURE!

      SUPER TUFF FIND!VINTAGE 1st PRODUCTION RUN REACTION STRIKE SWIMBAIT LURE!

      SUPER TUFF FIND!VINTAGE 1st PRODUCTION RUN REACTION STRIKE SWIMBAIT LURE!

      $1000.00
    • KRR One Piece Knocking Crawler Trout Topwater Crawler Bait Swimbait Bass Fishing

      KRR One Piece Knocking Crawler Trout Topwater Crawler Bait Swimbait Bass Fishing

      KRR One Piece Knocking Crawler Trout Topwater Crawler Bait Swimbait Bass Fishing

      $999.99
    • DRT Frenzy Clash 9 Low & Hi Tinyklash Set Queen Color Limited Swimbait New

      DRT Frenzy Clash 9 Low & Hi Tinyklash Set Queen Color Limited Swimbait New

      DRT Frenzy Clash 9 Low & Hi Tinyklash Set Queen Color Limited Swimbait New

      $999.00
    • Roman Made MOTHER Chaser Bora Swimbait Fishing Festival Limited Edition

      Roman Made MOTHER Chaser Bora Swimbait Fishing Festival Limited Edition

      Roman Made MOTHER Chaser Bora Swimbait Fishing Festival Limited Edition

      $696.67
    • Roman Made Floating Mother Swimbait 2023 Limited Edition Rare Model

      Roman Made Floating Mother Swimbait 2023 Limited Edition Rare Model

      Roman Made Floating Mother Swimbait 2023 Limited Edition Rare Model

      $696.67
    • DRT Deadringer Mud Shad Triple Joint Swimbait 8.25 Mud Shade Japan

      DRT Deadringer Mud Shad Triple Joint Swimbait 8.25 Mud Shade Japan

      DRT Deadringer Mud Shad Triple Joint Swimbait 8.25 Mud Shade Japan

      $752.00
    • DRT KLASH9 Low Floating RAINBOW-1 Old Package Japanese Fishing Lure Swimbait New

      DRT KLASH9 Low Floating RAINBOW-1 Old Package Japanese Fishing Lure Swimbait New

      DRT KLASH9 Low Floating RAINBOW

      $907.54
    • Slow Sinking Swimbait Propeller Fishing Lure 10g 22.5g Jerkbait Crankbait

      Slow Sinking Swimbait Propeller Fishing Lure 10g 22.5g Jerkbait Crankbait

      Slow Sinking Swimbait Propeller Fishing Lure 10g 22.5g Jerkbait Crankbait

      $899.00
    • DRT KLASH9 Low US CARP Japanese Fishing Lure Swimbait New

      DRT KLASH9 Low US CARP Japanese Fishing Lure Swimbait New

      DRT KLASH9 Low US CARP Japanese Fishing Lure Swimbait New

      $885.84
    • DRT KLASH9 Low Floating Public Domain 9in 4oz Japanese Fishing Lure Swimbait New

      DRT KLASH9 Low Floating Public Domain 9in 4oz Japanese Fishing Lure Swimbait New

      DRT KLASH9 Low Floating Public Domain 9in 4oz Japanese Fishing Lure Swimbait New

      $882.38
    •  Hinkle Shad Swimbait by Andrew Hinkle! Selling Collection!! Rare color!! 🔥

      Hinkle Shad Swimbait by Andrew Hinkle! Selling Collection!! Rare color!! 🔥

      Hinkle Shad Swimbait

      $875.00
    •  Hinkle Shad Swimbait by Andrew Hinkle! Selling Collection!! Rare color!! 🔥

      Hinkle Shad Swimbait by Andrew Hinkle! Selling Collection!! Rare color!! 🔥

      Hinkle Shad Swimbait

      $850.00
    • DRT Swimbait Underground Shadow Bag M Black Fishing Storage Case

      DRT Swimbait Underground Shadow Bag M Black Fishing Storage Case

      DRT Swimbait Underground Shadow Bag M Black Fishing Storage Case

      $801.79
    • DRT KLASH GHOST WRAITH Japanese Fishing Lure Swimbait New

      DRT KLASH GHOST WRAITH Japanese Fishing Lure Swimbait New

      DRT KLASH GHOST WRAITH Japanese Fishing Lure Swimbait New

      $837.08
    • DRT Swimbait Underground Tiny Crush Crash 9 Lure, Hard Bait, Fishing Gear

      DRT Swimbait Underground Tiny Crush Crash 9 Lure, Hard Bait, Fishing Gear

      DRT Swimbait Underground Tiny Crush Crash 9 Lure, Hard Bait, Fishing Gear

      $785.64
    • DRT KLASH 9 LOW 2 Set Low Float Swimbait Hasegawa Pink & Frosted Legend Chart

      DRT KLASH 9 LOW 2 Set Low Float Swimbait Hasegawa Pink & Frosted Legend Chart

      DRT KLASH 9 LOW 2 Set Low Float Swimbait Hasegawa Pink & Frosted Legend Chart

      $787.50
    • Roman Made AYUMU Woodream 3-Piece Swimbait Set Yokohama Fishing Festival

      Roman Made AYUMU Woodream 3-Piece Swimbait Set Yokohama Fishing Festival

      Roman Made AYUMU Woodream 3

      $586.22
    • Hinkle Trout Swimbait Painted by Andrew Hinkle Rare Fishing Lure 11 Inch Used

      Hinkle Trout Swimbait Painted by Andrew Hinkle Rare Fishing Lure 11 Inch Used

      Hinkle Trout Swimbait Painted

      $799.99
    • DRT KLASH9 Hi SPECTER Japanese Fishing Lure Swimbait New

      DRT KLASH9 Hi SPECTER Japanese Fishing Lure Swimbait New

      DRT KLASH9 Hi SPECTER Japanese Fishing Lure Swimbait New

      $796.36
    • Roman Made AYUMU Swimbait 3-Piece Set Woodream Limited Fishing Festival

      Roman Made AYUMU Swimbait 3-Piece Set Woodream Limited Fishing Festival

      Roman Made AYUMU Swimbait 3

      $675.00
    Page 1 of 546Next