Topwater Rats Are Crushing It Right NowShop SAC Pig
Frugal Lures

Green Pumpkin Trick Shakey Head Limited Pack

More from makerLive listings
$13.88
eBay logoFind on eBayAmazon logoFind on Amazon
View on fishingfrugallures.com

Affiliate disclosure: Some product links are affiliate links. Tackle.net earns from qualifying purchases.

Description

Shakey heads contain Mustad hooks and come fully assembled with trick style worms screwed into the hook! Included in this pack: x4 Screw Lock Shakey Heads in Green Pumpkin + 6″ Green Pumpkin Pepper trick style worms and silver colorado blade Note: Please allow 5 – 7 business days for assembly of your pack.

Fishing Profile

Best for
Bass, Largemouth
Presentation
Bottom, Finesse Shaking Vibration With Blade Flash
Techniques
Jigging, Finesse
Conditions
Clear Water, Dirty Water, Open Water
Size6 in (152 mm)
SeasonYear Round
CategoryJigs

Field Notes

Use on a shaky head setup by casting to structure or along the bottom, then gently shaking/dragging to keep the worm tail moving while the head stays near the substrate. Ideal when you want a finesse presentation that stays in the strike zone without heavy reeling.

Pros

  • Fully assembled with worm screwed into the hook for quick use
  • Mustad hooks for reliable penetration
  • Colorado blade adds flash and vibration

Cons

  • Limited pack size
  • Assembly time required (5–7 business days)

Keywords

greenpumpkintrickshakeyheadlimitedpackfrugalheadsmustadhooksfullyassembledstylewormsscrewedhookincluded

Share Link

Reviews

Community ratings and field notes for Green Pumpkin Trick Shakey Head Limited Pack.

No reviews yet
Write a review

Log in to rate this item and add photos.

Login to review
No reviews yet.

New lure drops in your inbox

Weekly custom bait finds, trending makers, expert videos, and saved-search recommendations.